Basic Information
| ID | DRAMP01507 |
| Sequence | GVFTLIKGATQLIGKTLGKELGKTGLELMACKITNQC |
| Length | 37 |
| Name | Esculentin-2-OR1 (Frogs, amphibians, animals) |
| Source | Odorrana rotodora (Chinese odorous frog) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
| Pathogen | Gram-negative bacterium: Escherichia coli ATCC 25922 (MIC=10.8 µg/mL);##Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (MIC=21.6 µg/mL), Bacillus pyocyaneus CMCCB 10104 (MIC=21.6 µg/mL).##Yeast: Candida albicans ATCC 2002 (MIC=10.8 µg/mL). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | [Ref.22029824]No cytotoxicity information found |
| N-terminal Modification | Free |
| C-terminal Modification | Cyclization (Cys31 and Cys37) |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot |
|
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 22029824 |
|---|