| ID | DRAMP03761 |
|---|---|
| Sequence | GLREKHVQKLVALIPNDQLRSILKAVVHKVAKTQFGCPAYEGYCNNHCQDIERKDGECHGFKCKCAKD |
| Length | 68 |
| Name | Scorpine-like peptide Tco 41.46-2 (Arthropods, animals) |
| Source | Tityus costatus (Brazilian scorpion) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q5G8A6, Q5G8A7 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15683865 |
Physicochemical Properties
| Residues | 68 |
|---|---|
| Sequence | GLREKHVQKLVALIPNDQLRSILKAVVHKVAKTQFGCPAYEGYCNNHCQDIERKDGECHGFKCKCAKD |
| Molecular Weight | 7683.835 |
| Grand Average of Hydropathy | -0.59 |
| Isoelectric Point | 8.816 |
| Charge at pH 7.4 | 3.537 |
| Secondary Structure | Helix: 0.250, Turn: 0.162, Sheet: 0.206 |
| Instability Index | 39.812 |
| Aromaticity | 0.059 |