| ID | DRAMP04252 |
|---|---|
| Sequence | GFKLKGMARISCLPNGQWSNFPPKCIRECAMVSS |
| Length | 34 |
| Name | Sushi peptide 1 (truncated fragment) |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 10973930 |
Physicochemical Properties
| Residues | 34 |
|---|---|
| Sequence | GFKLKGMARISCLPNGQWSNFPPKCIRECAMVSS |
| Molecular Weight | 3757.456 |
| Grand Average of Hydropathy | -0.103 |
| Isoelectric Point | 9.501 |
| Charge at pH 7.4 | 3.477 |
| Secondary Structure | Helix: 0.235, Turn: 0.353, Sheet: 0.206 |
| Instability Index | 43.418 |
| Aromaticity | 0.088 |