| ID | dbAMP22944 |
|---|---|
| Sequence | GFKLKGKAKISCLPNGQWSNFPPKCIRECAMVSS |
| Length | 34 |
| Name | S1? |
| Source | |
| Activity | Antibacterial |
| Pathogen | RBCs Source of Human (0% hemolysis at 100µg/ml (non-hemolytic))&&Pseudomonas aeruginosa (MIC90=<=0.03µg/ml)&&Pseudomonas aeruginosa (MIC50=<=0.03µg/ml)&&Pseudomonas aeruginosa (MBC90=0.25µg/ml)&&Pseudomonas aeruginosa (MBC50=<=0.03µg/ml) |
| Hemolytic Activity | Not included yet |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11557475 |
Physicochemical Properties
| Residues | 34 |
|---|---|
| Sequence | GFKLKGKAKISCLPNGQWSNFPPKCIRECAMVSS |
| Molecular Weight | 3726.419 |
| Grand Average of Hydropathy | -0.256 |
| Isoelectric Point | 9.652 |
| Charge at pH 7.4 | 4.473 |
| Secondary Structure | Helix: 0.235, Turn: 0.353, Sheet: 0.176 |
| Instability Index | 34.794 |
| Aromaticity | 0.088 |
