| ID | DRAMP04701 |
|---|---|
| Sequence | SLLELGKMILQETGKMPSKSYGAYGCNCGVLGR |
| Length | 33 |
| Name | Phospholipase A2 homolog (BmarPLA2, svPLA2 homolog) |
| Source | Bothrops marajoensis (Marajo lancehead) |
| Activity | Antimicrobial, Antibacterial, Antiparasitic |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P0DI92 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 19944711 |
Physicochemical Properties
| Residues | 33 |
|---|---|
| Sequence | SLLELGKMILQETGKMPSKSYGAYGCNCGVLGR |
| Molecular Weight | 3505.115 |
| Grand Average of Hydropathy | -0.048 |
| Isoelectric Point | 8.767 |
| Charge at pH 7.4 | 1.194 |
| Secondary Structure | Helix: 0.273, Turn: 0.333, Sheet: 0.303 |
| Instability Index | 53.848 |
| Aromaticity | 0.061 |