| ID | DRAMP18321 |
|---|---|
| Sequence | MAAFMKLIQFLATKGQKYVSLAWKRKGTILKWINAGQSFEWIYKQIKKLWA |
| Length | 51 |
| Name | Epidermicin NI01(Bacteriocin) |
| Source | Staphylococcus epidermidisstrain 224 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 22155816 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | MAAFMKLIQFLATKGQKYVSLAWKRKGTILKWINAGQSFEWIYKQIKKLWA |
| Molecular Weight | 6063.275 |
| Grand Average of Hydropathy | -0.045 |
| Isoelectric Point | 10.421 |
| Charge at pH 7.4 | 8.258 |
| Secondary Structure | Helix: 0.392, Turn: 0.118, Sheet: 0.275 |
| Instability Index | 21.261 |
| Aromaticity | 0.176 |
