| ID | DRAMP18355 |
|---|---|
| Sequence | MAAFMKLIQFLATKGQKYVSLAWKHKGTILKWINAGQSFEWIYKQIKKLWA |
| Length | 51 |
| Name | Lacticin Z (bacteriocin) |
| Source | Lactococcus lactis QU 14 |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Active against S. saprophyticus (MIC 82.3-160 nM), S. hominis, S. warneri, E. faecalis (MIC 160 nM), including multidrug-resistant S. epidermidis strains causing biofilm-related infections (MIC 10-658 nM), S. aureus 1195 (MRSA), and vancomycin-resistant enterococci (VRE) (MIC 160-329 nM). THe recombinant peptide shows activity against M. luteus and S. aureus strains in lawn assays. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | 2N8P |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17690480 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | MAAFMKLIQFLATKGQKYVSLAWKHKGTILKWINAGQSFEWIYKQIKKLWA |
| Molecular Weight | 6044.229 |
| Grand Average of Hydropathy | -0.02 |
| Isoelectric Point | 10.243 |
| Charge at pH 7.4 | 7.295 |
| Secondary Structure | Helix: 0.392, Turn: 0.118, Sheet: 0.275 |
| Instability Index | 19.512 |
| Aromaticity | 0.176 |