| ID | DRAMP00188 |
|---|---|
| Sequence | APAGLVAKFGRPIVKKYYKQIMQFIGEGSAINKIIPWIARMWRT |
| Length | 44 |
| Name | Enterocin RJ-11 (EntRJ-11; Bacteriocin) |
| Source | Enterococcus faecalis RJ-11 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Enterococcus faecalis RJ-11, Enterococcus sp. strain RB-3, Enterococcus sp. strain RJ-10, Enterococcus sp. strain SJ-16, Enterococcus sp. strain YJ-35, Enterococcus durans KB-60, Lactococcus lactis IFO12007, Leuconostoc mesenteroides IFO3426, Bacillus subtilis JCM1465, Bacillus amyloliquefaciens B1, Bacillus cereus B3, Listeria monocytogenes SUB635, Staphylococcus aureus SUB511. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 14532021 |
Physicochemical Properties
| Residues | 44 |
|---|---|
| Sequence | APAGLVAKFGRPIVKKYYKQIMQFIGEGSAINKIIPWIARMWRT |
| Molecular Weight | 5049.059 |
| Grand Average of Hydropathy | 0.064 |
| Isoelectric Point | 10.709 |
| Charge at pH 7.4 | 6.591 |
| Secondary Structure | Helix: 0.364, Turn: 0.205, Sheet: 0.205 |
| Instability Index | 25.5 |
| Aromaticity | 0.136 |