| ID | DRAMP18261 |
|---|---|
| Sequence | MGAIAKLVAKFGWPFIKKFYKQIMQFIGQGWTIDQIEKWLKRH |
| Length | 43 |
| Name | Enterocin 7B (Bacteriocin) |
| Source | Enterococcus faecalis 710C; Enterococcus faecalis MRR 10-3 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | broad-spectrum( mainly Gram-positive) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q1A2D2 |
| PDB | 2M60 |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 21469734, 23725536 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | MGAIAKLVAKFGWPFIKKFYKQIMQFIGQGWTIDQIEKWLKRH |
| Molecular Weight | 5182.204 |
| Grand Average of Hydropathy | -0.109 |
| Isoelectric Point | 10.218 |
| Charge at pH 7.4 | 5.303 |
| Secondary Structure | Helix: 0.395, Turn: 0.116, Sheet: 0.186 |
| Instability Index | 43.314 |
| Aromaticity | 0.186 |