| ID | DRAMP18262 |
|---|---|
| Sequence | MGAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIDWIKKHI |
| Length | 44 |
| Name | Enterocin 7A(Bacteriocin) |
| Source | Enterococcus faecalis MRR 10-3; Enterococcus faecalis 710C |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive (broad-spectrum) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q1A2D3 |
| PDB | 2M5Z resolved by NMR |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16751538, 23725536 |
Physicochemical Properties
| Residues | 44 |
|---|---|
| Sequence | MGAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIDWIKKHI |
| Molecular Weight | 5176.281 |
| Grand Average of Hydropathy | 0.202 |
| Isoelectric Point | 10 |
| Charge at pH 7.4 | 5.298 |
| Secondary Structure | Helix: 0.432, Turn: 0.136, Sheet: 0.182 |
| Instability Index | 20.068 |
| Aromaticity | 0.159 |