| ID | DRAMP18356 |
|---|---|
| Sequence | MAGLLRFLLSKGRALYNWAKSHVGKVWEWLKSGATYEQIKEWIENALGWR |
| Length | 50 |
| Name | BacSP222 (bacteriocin) |
| Source | isolated from dog skin lesions, Staphylococcus pseudintermedius strain 222 |
| Activity | Antibacterial, Mammalian cells, Antimicrobial |
| Pathogen | Active against B. subtilis ATCC 6633 (MIC 0.16 uM), L. lactis subsp. lactis LOCK 0871 strain 239 (MIC 0.89 uM), M. luteus ATCC 4698 (MIC 0.11 uM), S. aureus DSM 26258 (CH91), S. aureus MRSA USA300 strain FPR3757, S. aureus KB/8658, S. aureus ATCC 25923 (MIC 0.89-1.3 uM), S. epidermidis ATCC 35547 (MIC 4.4 uM), S. intermedius ATCC 29663, S. intermedius R-2725 (MIC 1.2-2 uM), S. pseudintermedius 222, S. pseudintermedius LMG 22219 (MIC 2.1 and 0.16 uM), S. saprophyticus ATCC 15305 (MIC 0.93 uM), S. pyogenes PCM 465 (MIC 7.8 uM), S. sanguinis PCM 2335 (MIC 3.5 uM), and C. albicans ATCC 10231 (MIC 100 uM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 26411997 |
Physicochemical Properties
| Residues | 50 |
|---|---|
| Sequence | MAGLLRFLLSKGRALYNWAKSHVGKVWEWLKSGATYEQIKEWIENALGWR |
| Molecular Weight | 5892.791 |
| Grand Average of Hydropathy | -0.304 |
| Isoelectric Point | 9.87 |
| Charge at pH 7.4 | 3.308 |
| Secondary Structure | Helix: 0.380, Turn: 0.200, Sheet: 0.340 |
| Instability Index | 9.21 |
| Aromaticity | 0.16 |