| ID | DRAMP18195 |
|---|---|
| Sequence | MKTILRFVAGYDIASHKKKTGGYPWERGKA |
| Length | 30 |
| Name | LsbB (Bacteriocin) |
| Source | Lactococcus lactis subsp. lactis (Streptococcus lactis) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | targeting primarily lactococcal cells |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q7X2B5 |
| PDB | 2MLU, 2MLV resolved by NMR |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12801935, 24993828 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | MKTILRFVAGYDIASHKKKTGGYPWERGKA |
| Molecular Weight | 3409.958 |
| Grand Average of Hydropathy | -0.683 |
| Isoelectric Point | 10.119 |
| Charge at pH 7.4 | 4.305 |
| Secondary Structure | Helix: 0.267, Turn: 0.200, Sheet: 0.200 |
| Instability Index | 31.41 |
| Aromaticity | 0.133 |