| ID | DRAMP03647 |
|---|---|
| Sequence | PIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQP |
| Length | 40 |
| Name | Cathelicidin-B1 (CATH-B1; cathelicidin; Birds, animals) |
| Source | Gallus gallus (Chicken) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-negative bacteria: Escherichia coli (MIC=2.5 µM), Pseudomonas aeruginosa (MIC=0.63 µM);##Gram-positive bacterium: Staphylococcus aureus (MIC=1.25 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q5F378, A7M6V2 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17827276, 15642098 |
Physicochemical Properties
| Residues | 40 |
|---|---|
| Sequence | PIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQP |
| Molecular Weight | 5028.785 |
| Grand Average of Hydropathy | -0.853 |
| Isoelectric Point | 12 |
| Charge at pH 7.4 | 6.934 |
| Secondary Structure | Helix: 0.375, Turn: 0.275, Sheet: 0.100 |
| Instability Index | 61.79 |
| Aromaticity | 0.15 |