Basic Information
| ID | DRAMP18424 |
|---|
| Sequence | TLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
|---|
| Length | 58 |
|---|
| Name | TLN-58 (TLN58; human cathelicidin) |
|---|
| Source | the lesion vesicle, skin, Homo sapiens |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | Active against S. aureus, S. epidermidis, and Group A Streptococcus. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 27771329 |
|---|
