| ID | DRAMP18241 |
|---|---|
| Sequence | TWATIGKTIVQSVKKCRTFTCGCSLGSCSNCN |
| Length | 32 |
| Name | Subtilomycin(Bacteriocin) |
| Source | Bacillus subtilis MMA7 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive, Gram-negative (broad spectrum) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 23736764 |
Physicochemical Properties
| Residues | 32 |
|---|---|
| Sequence | TWATIGKTIVQSVKKCRTFTCGCSLGSCSNCN |
| Molecular Weight | 3397.946 |
| Grand Average of Hydropathy | 0.087 |
| Isoelectric Point | 9.067 |
| Charge at pH 7.4 | 3.078 |
| Secondary Structure | Helix: 0.219, Turn: 0.281, Sheet: 0.062 |
| Instability Index | 20.963 |
| Aromaticity | 0.062 |
