| ID | DRAMP00109 |
|---|---|
| Sequence | KYYGNGLSCSKKGCTVNWGQAFSCGVNRVATAGHGK |
| Length | 36 |
| Name | Plantaricin C19 (Pediocin-like peptide; Bacteriocin) |
| Source | Lactobacillus plantarum C19 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacterium: Listeria grayi. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11545225 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | KYYGNGLSCSKKGCTVNWGQAFSCGVNRVATAGHGK |
| Molecular Weight | 3750.208 |
| Grand Average of Hydropathy | -0.425 |
| Isoelectric Point | 9.574 |
| Charge at pH 7.4 | 4.506 |
| Secondary Structure | Helix: 0.222, Turn: 0.361, Sheet: 0.111 |
| Instability Index | 18.067 |
| Aromaticity | 0.111 |