| ID | DRAMP18251 |
|---|---|
| Sequence | GDINGEFTTSPACVYSVMVVSKASSAKCAAGASAVSGAILSAIRC |
| Length | 45 |
| Name | Carnolysin A1(Bacteriocin) |
| Source | Carnobacterium maltaromaticum C2 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive(broad) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | W0FC94 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 24412962 |
Physicochemical Properties
| Residues | 45 |
|---|---|
| Sequence | GDINGEFTTSPACVYSVMVVSKASSAKCAAGASAVSGAILSAIRC |
| Molecular Weight | 4351.954 |
| Grand Average of Hydropathy | 0.702 |
| Isoelectric Point | 7.941 |
| Charge at pH 7.4 | 0.478 |
| Secondary Structure | Helix: 0.244, Turn: 0.311, Sheet: 0.267 |
| Instability Index | 30.007 |
| Aromaticity | 0.044 |