| ID | DRAMP18326 |
|---|---|
| Sequence | NGEWGYVVTKGAFQATTDVIANGWVSSLGGGYFGKP |
| Length | 36 |
| Name | Bovicin 255(Bacteriocin) |
| Source | Streptococcus bovis |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11157218 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | NGEWGYVVTKGAFQATTDVIANGWVSSLGGGYFGKP |
| Molecular Weight | 3735.074 |
| Grand Average of Hydropathy | -0.058 |
| Isoelectric Point | 6.068 |
| Charge at pH 7.4 | -0.451 |
| Secondary Structure | Helix: 0.333, Turn: 0.361, Sheet: 0.139 |
| Instability Index | -10.747 |
| Aromaticity | 0.167 |