| ID | DRAMP02310 |
|---|---|
| Sequence | AANFGPSVFTPEVHETWQKFLNVVVAALGKQYH |
| Length | 33 |
| Name | HbbetaP-1 (fish, chordates, animals) |
| Source | Ictalurus punctatus (Catfish) |
| Activity | Antimicrobial, Antibacterial, Antiparasitic |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18538841 |
Physicochemical Properties
| Residues | 33 |
|---|---|
| Sequence | AANFGPSVFTPEVHETWQKFLNVVVAALGKQYH |
| Molecular Weight | 3686.135 |
| Grand Average of Hydropathy | 0.018 |
| Isoelectric Point | 6.965 |
| Charge at pH 7.4 | -0.324 |
| Secondary Structure | Helix: 0.364, Turn: 0.212, Sheet: 0.242 |
| Instability Index | 17.736 |
| Aromaticity | 0.152 |