| ID | dbAMP28635 |
|---|---|
| Sequence | VTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR |
| Length | 35 |
| Name | Bovine hemoglobin alpha chain (107-141)&&?107–141 |
| Source | |
| Activity | Antibacterial |
| Pathogen | Staphylococcus aureus (MIC=43µM)&&Salmonella enteritidis (MIC=87µM)&&RBCs Source of Bovine (Non-hemolytic)&&Micrococcus luteus A270 (MIC=87µM)&&Micrococcus luteus (MIC=87µM)&&Listeria innocua (MIC=43µM)&&Escherichia coli (MIC=87µM) |
| Hemolytic Activity | Not included yet |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16730859 |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | VTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR |
| Molecular Weight | 3787.279 |
| Grand Average of Hydropathy | 0.231 |
| Isoelectric Point | 8.484 |
| Charge at pH 7.4 | 0.59 |
| Secondary Structure | Helix: 0.343, Turn: 0.229, Sheet: 0.257 |
| Instability Index | 14.386 |
| Aromaticity | 0.086 |