| ID | DRAMP02850 |
|---|---|
| Sequence | KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK |
| Length | 39 |
| Name | Casocidin-1 (mammals, animals) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Staphylococcus carnosus, Escherichia coli. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P02663, Q1RMQ6, Q9TR51 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 7556666 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK |
| Molecular Weight | 4869.624 |
| Grand Average of Hydropathy | -1.326 |
| Isoelectric Point | 10.076 |
| Charge at pH 7.4 | 6.57 |
| Secondary Structure | Helix: 0.308, Turn: 0.103, Sheet: 0.231 |
| Instability Index | 27.854 |
| Aromaticity | 0.128 |