Basic Information
| ID | DRAMP00213 |
|---|
| Sequence | STPVLASVAVSMELLPTASVLYSDVAGCFKYSAKHHC |
|---|
| Length | 37 |
|---|
| Name | Lactocin S (Bacteriocin) |
|---|
| Source | Lactobacillus sakei L45 (Gram-positive bacteria) |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | Leuconostoc, Carnobacteria, Lactobacilli, Pediococci, Lactococci, Listeria monocytogenes, Listeria innocua, Staphylococcus, Bacillus cereus, Clostridium spp. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Deaminated |
|---|
| C-terminal Modification | Cyclization between S32 and C37 |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P23826, Q48848, Q48858 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 1872611, 7961627 |
|---|
