Basic Information
| ID | DRAMP00086 |
|---|
| Sequence | TKYYGNGVYCNSKKCWVDWGTAQGCIDVVIGQLGGGIPGKGKC |
|---|
| Length | 43 |
|---|
| Name | Divergicin M35 (Pediocin-like peptide; Bacteriocin) |
|---|
| Source | Carnobacterium divergens M35 (Gram-positive bacteria) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
|---|
| Pathogen | Gram-positive bacteria: Many strains of Listeria monocytogenes, L. seeligeri, L. welshimeri, L. grayi, L. murayi, L. ivanovii, L. innocus, Ceanothus divergens and Carnobacterium piscicola. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P84962 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 15541799 |
|---|
