| ID | DRAMP00072 |
|---|---|
| Sequence | AYPGNGVHCGKYSCTVDKQTAIGNIGNNAA |
| Length | 30 |
| Name | Bacteriocin curvaticin |
| Source | Lactobacillus curvatus L442 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Listeria monocytogenes, Lactobacillus sakeii, Lactobacillus plantarum, Lactobacillus farciminis. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P84886 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16244793 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | AYPGNGVHCGKYSCTVDKQTAIGNIGNNAA |
| Molecular Weight | 3024.304 |
| Grand Average of Hydropathy | -0.36 |
| Isoelectric Point | 8.07 |
| Charge at pH 7.4 | 0.586 |
| Secondary Structure | Helix: 0.200, Turn: 0.367, Sheet: 0.133 |
| Instability Index | 33.87 |
| Aromaticity | 0.067 |