| ID | DRAMP00091 |
|---|---|
| Sequence | AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH |
| Length | 43 |
| Name | Carnobacteriocin BM1 (Carnobacteriocin B1; Bacteriocin) |
| Source | Carnobacterium piscicola LV17B (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Listeria and Enterococcus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P38579 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8163526 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH |
| Molecular Weight | 4527.125 |
| Grand Average of Hydropathy | -0.077 |
| Isoelectric Point | 8.764 |
| Charge at pH 7.4 | 1.583 |
| Secondary Structure | Helix: 0.279, Turn: 0.326, Sheet: 0.209 |
| Instability Index | 26.921 |
| Aromaticity | 0.093 |