| ID | DRAMP00080 |
|---|---|
| Sequence | ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM |
| Length | 41 |
| Name | Curvacin A (Bacteriocin) |
| Source | Lactobacillus curvatus LTH1174 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Closely related Lactobacilli, Listeria monocytogenes and ivanovvi, Enterococcus faecalis, Carnobacterium sp and Brocothrix thermosphacta. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P0A311, P35619, P80097 |
| PDB | 2A2B |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 7694558, 16331975 |
Physicochemical Properties
| Residues | 41 |
|---|---|
| Sequence | ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM |
| Molecular Weight | 4308.856 |
| Grand Average of Hydropathy | -0.185 |
| Isoelectric Point | 9.307 |
| Charge at pH 7.4 | 2.55 |
| Secondary Structure | Helix: 0.244, Turn: 0.390, Sheet: 0.195 |
| Instability Index | 27.629 |
| Aromaticity | 0.098 |