Basic Information
| ID | DRAMP00069 |
|---|
| Sequence | EYHLMNGANGYLTRVNGKTVYRVTKDPVSAVFGVISNCWGSAGAGFGPQH |
|---|
| Length | 50 |
|---|
| Name | Garvieacin Q (GarQ; Bacteriocin) |
|---|
| Source | Lactococcus garvieae BCC 43578 (Gram-positive bacteria) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
|---|
| Pathogen | Gram-positive bacteria: Bacillus coagulans JCM 2257, Listeria monocytogenes ATCC 19115, L. garvieae strains, E. faecium D48S52, Lactobacillus plantarum BCC 9546, Lactobacillus sakeii JCM 1157, L. ivanovii DMST 9012 (MIC=0.1-1.6 uM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | [Ref.22210221] Purified GarQ, up to 1 mg/mL, was not cytotoxic to Vero (African green monkey kidney), HepG (human liver hepatocarcinoma) and Caco-2 (human colon adenocarcinoma) cell lines. Vero, HepG2 and Caco-2 have 94 ± 8, 97 ± 4 and 89 ± 7 % survival with indicated concentration (1mg/mL) of purified garvieacin Q compared to that of untreated control using the MTT assay. |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Linear |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 22210221 |
|---|
