Basic Information
| ID | DRAMP00164 |
|---|
| Sequence | LAGYTGIASGTAKKVVDAIDKGAAAFVIISIISTVISAGALGAVSASADFIILTVKNYISRNLKAQAVIW |
|---|
| Length | 70 |
|---|
| Name | Bacteriocin uberolysin (Bacteriocin) |
|---|
| Source | Streptococcus uberis strain 42 (Gram-positive bacteria) |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | Most streptococci (except S.rattus and S. mutans), Listeria spp., enterococci and staphylococci. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | No specific N-terminal |
|---|
| C-terminal Modification | No specific C-terminal |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
A5H1G9 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 17464077 |
|---|
