| ID | DRAMP18265 |
|---|---|
| Sequence | MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW |
| Length | 70 |
| Name | Enterocin RM6 (Bacteriocin) |
| Source | Enterococcus faecalis OSY-RM6 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 23844357 |
Physicochemical Properties
| Residues | 70 |
|---|---|
| Sequence | MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW |
| Molecular Weight | 7167.462 |
| Grand Average of Hydropathy | 0.539 |
| Isoelectric Point | 10.092 |
| Charge at pH 7.4 | 5.267 |
| Secondary Structure | Helix: 0.343, Turn: 0.214, Sheet: 0.329 |
| Instability Index | 18.819 |
| Aromaticity | 0.057 |
