| ID | DRAMP18212 |
|---|---|
| Sequence | LASTLGISTAAAKKAIDIIDAASTIASIISLIGIVTGAGAISYAIVATAKTMIKKYGKKYAAAW |
| Length | 64 |
| Name | Amylocyclicin(Bacteriocin) |
| Source | Bacillus amyloliquefaciens FZB42 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | No specific N-terminal |
| C-terminal Modification | No specific C-terminal |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 24610713 |
Physicochemical Properties
| Residues | 64 |
|---|---|
| Sequence | LASTLGISTAAAKKAIDIIDAASTIASIISLIGIVTGAGAISYAIVATAKTMIKKYGKKYAAAW |
| Molecular Weight | 6399.538 |
| Grand Average of Hydropathy | 0.85 |
| Isoelectric Point | 9.825 |
| Charge at pH 7.4 | 4.533 |
| Secondary Structure | Helix: 0.328, Turn: 0.172, Sheet: 0.312 |
| Instability Index | 2.652 |
| Aromaticity | 0.062 |