| ID | DRAMP00173 |
|---|---|
| Sequence | LVNQLGISKSLANTILGAIAVGNLASWVLALVPGPGWATKAALATAETIVKHEGKAAAIAW |
| Length | 61 |
| Name | Leucocyclicin Q (Bacteriocin) |
| Source | Leuconostoc mesenteroides TK41401 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacteria: Lactococcus lactis ssp. lactis JCM 7638 (MIC=0.038 µM), L. lactis ssp. lactis ATCC 19435 (MIC=0.038 µM), L. sp. QU 12 (MIC=1.203 µM), Lactobacillus sakei ssp. sakei JCM 1157 (MIC=0.038 µM), Weissella cibaria JCM 12495 (MIC=2.405 µM), W. paramesenteroides JCM 9890 (MIC=0.075 µM), Pediococcus pentosaceus JCM 5885 (MIC=2.405 µM), P. dextrinicus JCM 5887 (MIC=0.038 µM), Enterococcus faecium JCM 5804 (MIC=0.038 µM), E. faecalis JCM 5803 (MIC=0.15 µM), Streptococcus salivarius JCM 5707 (MIC=2.405 µM), S. bovis JCM 5802 (MIC=0.601 µM), S. mutans JCM 5705 (MIC=19.25 µM), Bacillus coagulans JCM 2257 (MIC=0.075 µM), B. subtilis ssp. subtilis JCM 1465 (MIC=0.601 µM), B. cereus JCM 2152 (MIC=2.405 µM), Kocuria rhizophila NBRC 12708 (MIC=9.623 µM), Listeria innocua ATCC 33090 (MIC=0.601 µM), Leuconostoc mesenteroides ssp. mes. JCM 6124 (MIC=0.3 µM), Escherichia coli JM109 (MIC=38.49 µM), E. coli NBRC 3301 (MIC=38.49 µM) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | Cyclization (N termini to C termini) |
| C-terminal Modification | Cyclization (C termini to N termini) |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot | G5ELQ0 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 21948835 |
Physicochemical Properties
| Residues | 61 |
|---|---|
| Sequence | LVNQLGISKSLANTILGAIAVGNLASWVLALVPGPGWATKAALATAETIVKHEGKAAAIAW |
| Molecular Weight | 6119.119 |
| Grand Average of Hydropathy | 0.751 |
| Isoelectric Point | 9.528 |
| Charge at pH 7.4 | 1.586 |
| Secondary Structure | Helix: 0.344, Turn: 0.230, Sheet: 0.393 |
| Instability Index | 2.867 |
| Aromaticity | 0.049 |