| ID | DRAMP18255 |
|---|---|
| Sequence | VAGALGVQTAAATTIVNVILNAGTLVTVLGIIASIASGGAGTLMTIGWATFKATVQKLAKQSMARAIAY |
| Length | 69 |
| Name | Circularin A(Bacteriocin) |
| Source | Clostridium beijerinckii ATCC 25752 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive(broad) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | No specific N-terminal |
| C-terminal Modification | No specific C-terminal |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot | Q8GB47 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12620847, 14532033 |
Physicochemical Properties
| Residues | 69 |
|---|---|
| Sequence | VAGALGVQTAAATTIVNVILNAGTLVTVLGIIASIASGGAGTLMTIGWATFKATVQKLAKQSMARAIAY |
| Molecular Weight | 6788.971 |
| Grand Average of Hydropathy | 1.007 |
| Isoelectric Point | 10.461 |
| Charge at pH 7.4 | 3.513 |
| Secondary Structure | Helix: 0.333, Turn: 0.188, Sheet: 0.333 |
| Instability Index | 14.977 |
| Aromaticity | 0.043 |