| ID | DRAMP03169 |
|---|---|
| Sequence | RARAPHKAWYNCMTDAGISGAIAGAVAGCAATIEIGCVEGAIAGIGPSGIASMIAALWTCRSKY |
| Length | 64 |
| Name | Protease-activated antimicrobial peptide |
| Source | Propionibacterium jensenii |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Propionibacterium acidipropionici ATCC 4965 (MIC=3.6 nM), P. acidipropionici ATCC 4875 (MIC=7.2 nM), P. acidipropionici (MIC=3.6 nM), P. freudenreichii subsp. freudenreichii ATCC 6207T (MIC=7.2 nM), P. freudenreichii INF-P203 (MIC=116 nM), P. freudenreichii INF-P205 (MIC=58 nM), P. jensenii LMG 2820 (MIC=116 nM), P. jensenii LMG 3032 (MIC=116 nM), P. thoenii INF-P410 (MIC=116 nM), P. thoenii INF-P414 (MIC=0.9 nM), Lactobacillus delbrueckii subsp. lactis ATCC 4797 (MIC=0.5 nM), L. delbrueckii subsp. lactis DSM 20072T (MIC=0.2 nM), L. delbrueckii subsp. bulgaricus DSM 20081T (MIC=7.2 nM), L. helveticus DSM 20075T (MIC=0.9 nM), Lactobacillus plantarum LMG 2003 (MIC=116 nM), L. sakei NCDO 2714 (MIC=0.9 nM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12057960 |
Physicochemical Properties
| Residues | 64 |
|---|---|
| Sequence | RARAPHKAWYNCMTDAGISGAIAGAVAGCAATIEIGCVEGAIAGIGPSGIASMIAALWTCRSKY |
| Molecular Weight | 6383.366 |
| Grand Average of Hydropathy | 0.531 |
| Isoelectric Point | 8.504 |
| Charge at pH 7.4 | 1.489 |
| Secondary Structure | Helix: 0.234, Turn: 0.250, Sheet: 0.312 |
| Instability Index | 32.711 |
| Aromaticity | 0.062 |