| ID | DRAMP18259 |
|---|---|
| Sequence | LGSCVANKIKDEFFAMISISAIVKAAQKKAWKELAVTVLRFAKANGLKTNAIIVAGQLALWAVQCGLS |
| Length | 68 |
| Name | Enterocin O16 (Bacteriocin) |
| Source | Enterococcus faecalis |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive(certain) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 25733609 |
Physicochemical Properties
| Residues | 68 |
|---|---|
| Sequence | LGSCVANKIKDEFFAMISISAIVKAAQKKAWKELAVTVLRFAKANGLKTNAIIVAGQLALWAVQCGLS |
| Molecular Weight | 7219.583 |
| Grand Average of Hydropathy | 0.622 |
| Isoelectric Point | 9.836 |
| Charge at pH 7.4 | 5.491 |
| Secondary Structure | Helix: 0.353, Turn: 0.162, Sheet: 0.338 |
| Instability Index | 7.681 |
| Aromaticity | 0.074 |