| ID | DRAMP02312 |
|---|---|
| Sequence | SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL |
| Length | 51 |
| Name | Hipposin (fish, chordates, animals) |
| Source | Hippoglossus hippoglossus (Atlantic halibut) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Gram+ (MIC=0.3 µM);##Gram- (MIC=0.3 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P59890 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12637028 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL |
| Molecular Weight | 5416.225 |
| Grand Average of Hydropathy | -0.68 |
| Isoelectric Point | 12 |
| Charge at pH 7.4 | 12.309 |
| Secondary Structure | Helix: 0.216, Turn: 0.294, Sheet: 0.216 |
| Instability Index | 37.041 |
| Aromaticity | 0.059 |