Basic Information
| ID | DRAMP18380 |
|---|
| Sequence | SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVY |
|---|
| Length | 50 |
|---|
| Name | Acipensin 1 (Ac1) |
|---|
| Source | Leukocytes; the Russian Sturgeon, Acipenser gueldenstaedtii |
|---|
| Activity | Antimicrobial, Antibacterial, Antifungal |
|---|
| Pathogen | Active against E. coli ML35p (MIC 0.7 uM), L. monocytogenes EGD (MIC 1.1 uM), MRSA ATCC 33591 (MIC 0.9 uM), C. albicans 820 (MIC 1 uM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 25558400 |
|---|
