Basic Information
| ID | DRAMP01162 |
|---|
| Sequence | AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY |
|---|
| Length | 39 |
|---|
| Name | Buforin-1 (Buforin I; Fragment of Histone H2A; toads, amphibians, animals) |
|---|
| Source | Bufo gargarizans (Asian toad) (Bufo bufo gargarizans) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | Gram-positive bacteria: Bacillus subtilis (MIC=4 µg/ml), Staphylococcus aureus (MIC=4 µg/ml), Streptococcus mutans (MIC=8 µg/ml), Streptococcus pneumoniae (MIC=4 µg/ml), Pseudomonas putida (MIC=4 µg/ml);##Gram-negative bacteria: Escherichia coli (MIC=8 µg/ml), Salmonella typhimurium (MIC=4 µg/ml), Serratia sp. (MIC=8 µg/ml).##Fungi: Candida albicans (MIC=4 µg/ml), Cryptococcus neoformans (MIC=4 µg/ml), Saccharomyces cerevisiae (MIC=4 µg/ml). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Linear |
|---|
| Uniprot |
P55897 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 8573171, 8946958 |
|---|
