Basic Information
| ID | DRAMP18377 |
|---|
| Sequence | MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLK |
|---|
| Length | 38 |
|---|
| Name | Sphistin (histone-derived, Crustaceans, arthropods, invertebrates, animals) |
|---|
| Source | haemolymphs, Scylla paramamosain |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | Active against G+ bacteria (S. aureus, C. glutamicum, B. subtilis, M. lysodeikticus, M. luteus) and G- bacteria (S. flexneri, P. stutzeri, and P. fluorescens) (MIC < 1.5 uM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 25558400 |
|---|
