| ID | DRAMP02651 |
|---|---|
| Sequence | GDVPPGIRNTICLMQQGTCRLFFCHSGEKKRDICSDPWNRCCVSNRDEEGKEKPKTDGRSGI |
| Length | 62 |
| Name | Sperm associated antigen 11 isoform E (primates, mammals, animals) |
| Source | Macaca mulatta (Rhesus monkey) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15229135 |
Physicochemical Properties
| Residues | 62 |
|---|---|
| Sequence | GDVPPGIRNTICLMQQGTCRLFFCHSGEKKRDICSDPWNRCCVSNRDEEGKEKPKTDGRSGI |
| Molecular Weight | 6970.849 |
| Grand Average of Hydropathy | -0.929 |
| Isoelectric Point | 8.319 |
| Charge at pH 7.4 | 1.441 |
| Secondary Structure | Helix: 0.177, Turn: 0.290, Sheet: 0.113 |
| Instability Index | 36.931 |
| Aromaticity | 0.048 |