| ID | DRAMP03399 |
|---|---|
| Sequence | PGDIPPGIRNTVCLMQQGHCRLFMCRSGERKGDICSDPWNRCCVPYSVKDRR |
| Length | 52 |
| Name | Sperm-associated antigen 11 (Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacterium: Escherichia coli. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8K4N2, Q2HPE4, Q30KM3 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865, 12193721 |
Physicochemical Properties
| Residues | 52 |
|---|---|
| Sequence | PGDIPPGIRNTVCLMQQGHCRLFMCRSGERKGDICSDPWNRCCVPYSVKDRR |
| Molecular Weight | 5952.882 |
| Grand Average of Hydropathy | -0.654 |
| Isoelectric Point | 8.979 |
| Charge at pH 7.4 | 3.786 |
| Secondary Structure | Helix: 0.212, Turn: 0.288, Sheet: 0.096 |
| Instability Index | 36.475 |
| Aromaticity | 0.058 |