| ID | DRAMP03423 |
|---|---|
| Sequence | DIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR |
| Length | 49 |
| Name | BIN1b (Sperm-associated antigen 11; Antimicrobial-like protein Bin-1b; Rodents, mammals, animals) |
| Source | Rattus norvegicus (Rat) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacterium: Escherichia coli. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8VBV2 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11230693 |
Physicochemical Properties
| Residues | 49 |
|---|---|
| Sequence | DIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR |
| Molecular Weight | 5631.51 |
| Grand Average of Hydropathy | -0.569 |
| Isoelectric Point | 9.215 |
| Charge at pH 7.4 | 4.444 |
| Secondary Structure | Helix: 0.204, Turn: 0.306, Sheet: 0.082 |
| Instability Index | 21.137 |
| Aromaticity | 0.061 |