| ID | DRAMP03289 |
|---|---|
| Sequence | FFLLFLQGAAGNSVLCRIRGGRCHVGSCHFPERHIGRCSGFQACCIRTWG |
| Length | 50 |
| Name | Apl-AvBD16 (Beta defensins; Ducks, birds, animals) |
| Source | Anas platyrhynchos (Peking duck) |
| Activity | Antimicrobial, Antibacterial, Antiviral |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 23112840 |
Physicochemical Properties
| Residues | 50 |
|---|---|
| Sequence | FFLLFLQGAAGNSVLCRIRGGRCHVGSCHFPERHIGRCSGFQACCIRTWG |
| Molecular Weight | 5526.419 |
| Grand Average of Hydropathy | 0.242 |
| Isoelectric Point | 9.303 |
| Charge at pH 7.4 | 4.521 |
| Secondary Structure | Helix: 0.300, Turn: 0.260, Sheet: 0.160 |
| Instability Index | 53.158 |
| Aromaticity | 0.12 |