| ID | DRAMP03608 |
|---|---|
| Sequence | KFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTPKKD |
| Length | 51 |
| Name | Beta-defensin 108B (Beta-defensin 8; hBD-8; Defensin, beta 108B; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8NET1 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11854508 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | KFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTPKKD |
| Molecular Weight | 5815.647 |
| Grand Average of Hydropathy | -0.759 |
| Isoelectric Point | 7.79 |
| Charge at pH 7.4 | 0.481 |
| Secondary Structure | Helix: 0.196, Turn: 0.255, Sheet: 0.176 |
| Instability Index | 60.555 |
| Aromaticity | 0.039 |
