| ID | DRAMP02754 |
|---|---|
| Sequence | GWKDWLKKGKEWLKAKGPGIVKAALQAATQ |
| Length | 30 |
| Name | Ponericin G2 (ants, insects, animals) |
| Source | Pachycondyla goeldii (Ponerine ant) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | Saccharomyces cerevisae |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P82415 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11279030 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | GWKDWLKKGKEWLKAKGPGIVKAALQAATQ |
| Molecular Weight | 3307.886 |
| Grand Average of Hydropathy | -0.627 |
| Isoelectric Point | 10.126 |
| Charge at pH 7.4 | 4.541 |
| Secondary Structure | Helix: 0.267, Turn: 0.167, Sheet: 0.300 |
| Instability Index | 4.58 |
| Aromaticity | 0.1 |