| ID | DRAMP02757 |
|---|---|
| Sequence | GLKDWVKIAGGWLKKKGPGILKAAMAAATQ |
| Length | 30 |
| Name | Ponericin G5 (ants, insects, animals) |
| Source | Pachycondyla goeldii (Ponerine ant) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | [Swiss_Prot Entry P82418]has antibacterial activity |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P82418 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11279030 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | GLKDWVKIAGGWLKKKGPGILKAAMAAATQ |
| Molecular Weight | 3108.743 |
| Grand Average of Hydropathy | 0.027 |
| Isoelectric Point | 10.302 |
| Charge at pH 7.4 | 4.543 |
| Secondary Structure | Helix: 0.267, Turn: 0.200, Sheet: 0.333 |
| Instability Index | 9.257 |
| Aromaticity | 0.067 |