| ID | DRAMP02595 |
|---|---|
| Sequence | GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL |
| Length | 32 |
| Name | Styelin-D (Styelin D; chordates) |
| Source | Styela clava (Sea squirt) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O18495 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9257708, 10978343 |
Physicochemical Properties
| Residues | 32 |
|---|---|
| Sequence | GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL |
| Molecular Weight | 3811.483 |
| Grand Average of Hydropathy | -0.566 |
| Isoelectric Point | 10.24 |
| Charge at pH 7.4 | 7.603 |
| Secondary Structure | Helix: 0.375, Turn: 0.125, Sheet: 0.219 |
| Instability Index | 38.107 |
| Aromaticity | 0.219 |
