| ID | DRAMP03129 |
|---|---|
| Sequence | GRSKKLGKKIEKAGKRVFNAAQKGLPVAAGVQAL |
| Length | 34 |
| Name | Cecropin-B2 (Insects, animals) |
| Source | Culex pipiens pipiens (Northern house mosquito) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q86PR4 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 34 |
|---|---|
| Sequence | GRSKKLGKKIEKAGKRVFNAAQKGLPVAAGVQAL |
| Molecular Weight | 3520.181 |
| Grand Average of Hydropathy | -0.371 |
| Isoelectric Point | 11.301 |
| Charge at pH 7.4 | 7.541 |
| Secondary Structure | Helix: 0.235, Turn: 0.235, Sheet: 0.294 |
| Instability Index | 43.985 |
| Aromaticity | 0.029 |