| ID | DRAMP03131 |
|---|---|
| Sequence | GGLKKLGKKLEGVGKRVFKASEKALPVLTGYKAIG |
| Length | 35 |
| Name | Cecropin-B (Insects, animals) |
| Source | Aedes albopictus (Asian tiger mosquito) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q9Y0Y0, Q963A9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 10413113 |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | GGLKKLGKKLEGVGKRVFKASEKALPVLTGYKAIG |
| Molecular Weight | 3642.382 |
| Grand Average of Hydropathy | -0.16 |
| Isoelectric Point | 10.297 |
| Charge at pH 7.4 | 6.537 |
| Secondary Structure | Helix: 0.314, Turn: 0.257, Sheet: 0.286 |
| Instability Index | 15.363 |
| Aromaticity | 0.057 |