| ID | DRAMP02905 |
|---|---|
| Sequence | KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG |
| Length | 38 |
| Name | Hinnavin II |
| Source | Artogeia rapae |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q68KS5 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16616565 |
Physicochemical Properties
| Residues | 38 |
|---|---|
| Sequence | KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG |
| Molecular Weight | 4194.944 |
| Grand Average of Hydropathy | -0.205 |
| Isoelectric Point | 10.122 |
| Charge at pH 7.4 | 4.578 |
| Secondary Structure | Helix: 0.316, Turn: 0.184, Sheet: 0.184 |
| Instability Index | 18.837 |
| Aromaticity | 0.079 |
