| ID | dbAMP28221 |
|---|---|
| Sequence | KWKLFKKIEKVGQNIRDGIIKAGPGIGAVLKVLTTGL |
| Length | 37 |
| Name | CA(1-24)M(1-13) |
| Source | |
| Activity | Antibacterial |
| Pathogen | RBCs Source of Sheep (Lethal concentration calculated from zone of inhibition >200µM) |
| Hemolytic Activity | Not included yet |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 2689223 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | KWKLFKKIEKVGQNIRDGIIKAGPGIGAVLKVLTTGL |
| Molecular Weight | 3990.822 |
| Grand Average of Hydropathy | 0.124 |
| Isoelectric Point | 10.391 |
| Charge at pH 7.4 | 5.541 |
| Secondary Structure | Helix: 0.378, Turn: 0.216, Sheet: 0.189 |
| Instability Index | 4.178 |
| Aromaticity | 0.054 |